Lineage for d5bk8a1 (5bk8 A:3-110)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572438Domain d5bk8a1: 5bk8 A:3-110 [383305]
    Other proteins in same PDB: d5bk8a3
    automated match to d2b3oa1
    mutant

Details for d5bk8a1

PDB Entry: 5bk8 (more details), 2.25 Å

PDB Description: cancer-associated shp2/t507k mutant
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d5bk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bk8a1 d.93.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

SCOPe Domain Coordinates for d5bk8a1:

Click to download the PDB-style file with coordinates for d5bk8a1.
(The format of our PDB-style files is described here.)

Timeline for d5bk8a1: