![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
![]() | Protein automated matches [190150] (36 species) not a true protein |
![]() | Species Geobacillus kaustophilus [TaxId:235909] [383298] (3 PDB entries) |
![]() | Domain d6jstc_: 6jst C: [383300] automated match to d3e3ha_ complexed with fe, lae, oh, zn; mutant |
PDB Entry: 6jst (more details), 1.73 Å
SCOPe Domain Sequences for d6jstc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jstc_ c.1.9.0 (C:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg iqtvvdptpndcgrnpaflrrvaeetglniicatgypyegegappyfqfrrllgtaeddi ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd eervrtllallrdgyekqimlshntvnvwlgrpftlpepfaemmknwhvehlfvniipal knegirdevleqmfignpaalfs
Timeline for d6jstc_: