SCOPe 2.03: Domain d2ucza_: 2ucz A:

Lineage for d2ucza_ (2ucz A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId:4932] [54501] (1 PDB entry)

8. Domain d2ucza_: 2ucz A: [38330]

Details for d2ucza_

PDB Entry: 2ucz, 2.93 Å

PDB Description: ubiquitin conjugating enzyme (ubc7) from saccharomyces cerevisiae

PDB Compounds: (A:) ubiquitin conjugating enzyme

SCOPe Domain Sequences for d2ucza_:

Sequence; same for both SEQRES and ATOM records:

>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]}
sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill
svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf

Timeline for d2ucza_:

• d2ucza_ first appeared (with stable ids) in SCOP 1.55, called d2ucz__
  
• d2ucza_ appears in SCOPe 2.02
  
• d2ucza_ appears in SCOPe 2.04
  
• d2ucza_ appears in the current release, SCOPe 2.08