Lineage for d2ucza_ (2ucz A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198745Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1198775Species Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId:4932] [54501] (1 PDB entry)
  8. 1198776Domain d2ucza_: 2ucz A: [38330]

Details for d2ucza_

PDB Entry: 2ucz (more details), 2.93 Å

PDB Description: ubiquitin conjugating enzyme (ubc7) from saccharomyces cerevisiae
PDB Compounds: (A:) ubiquitin conjugating enzyme

SCOPe Domain Sequences for d2ucza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]}
sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill
svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf

SCOPe Domain Coordinates for d2ucza_:

Click to download the PDB-style file with coordinates for d2ucza_.
(The format of our PDB-style files is described here.)

Timeline for d2ucza_: