Lineage for d2ucz__ (2ucz -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132102Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)
  4. 132103Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) (S)
  5. 132104Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)
  6. 132105Protein Ubiquitin conjugating enzyme [54497] (13 species)
  7. 132124Species Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId:4932] [54501] (1 PDB entry)
  8. 132125Domain d2ucz__: 2ucz - [38330]

Details for d2ucz__

PDB Entry: 2ucz (more details), 2.93 Å

PDB Description: ubiquitin conjugating enzyme (ubc7) from saccharomyces cerevisiae

SCOP Domain Sequences for d2ucz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ucz__ d.20.1.1 (-) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc7}
sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill
svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf

SCOP Domain Coordinates for d2ucz__:

Click to download the PDB-style file with coordinates for d2ucz__.
(The format of our PDB-style files is described here.)

Timeline for d2ucz__: