Lineage for d6vo6d_ (6vo6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846457Species Campylobacter jejuni [TaxId:192222] [225997] (8 PDB entries)
  8. 2846463Domain d6vo6d_: 6vo6 D: [383291]
    automated match to d3slgf_
    complexed with cl, edo, gdp, na, nai, tma

Details for d6vo6d_

PDB Entry: 6vo6 (more details), 1.5 Å

PDB Description: crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp
PDB Compounds: (D:) Putative sugar-nucleotide epimerase/dehydratease

SCOPe Domain Sequences for d6vo6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vo6d_ c.2.1.0 (D:) automated matches {Campylobacter jejuni [TaxId: 192222]}
skkvlitggagyigsvltpillekgyevcvidnlmfdqisllscfhnknftfingdamde
nlirqevakadiiiplaalvgaplckrnpklakminyeavkmisdfaspsqifiypntns
gygigekdamcteesplrpiseygidkvhaeqylldkgncvtfrlatvfgisprmrldll
vndftyrayrdkfivlfeehfrrnyihvrdvvkgfihgienydkmkgqaynmglssanlt
krqlaetikkyipdfyihsanigedpdkrdylvsntkleatgwkpdntledgikellraf
kmmkvnrfanf

SCOPe Domain Coordinates for d6vo6d_:

Click to download the PDB-style file with coordinates for d6vo6d_.
(The format of our PDB-style files is described here.)

Timeline for d6vo6d_: