Lineage for d6v7qa_ (6v7q A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2502019Protein automated matches [190118] (17 species)
    not a true protein
  7. 2502050Species Human (Homo sapiens) [TaxId:9606] [189560] (112 PDB entries)
  8. 3083221Domain d6v7qa_: 6v7q A: [383283]
    automated match to d1y8rc_
    complexed with sep

Details for d6v7qa_

PDB Entry: 6v7q (more details), 1.35 Å

PDB Description: crystal structure of sumo1 in complex with phosphorylated pias-sim2
PDB Compounds: (A:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d6v7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v7qa_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqt

SCOPe Domain Coordinates for d6v7qa_:

Click to download the PDB-style file with coordinates for d6v7qa_.
(The format of our PDB-style files is described here.)

Timeline for d6v7qa_:

  • d6v7qa_ is new in SCOPe 2.07-stable