Lineage for d1ayzb_ (1ayz B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1406979Species Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId:4932] [54499] (1 PDB entry)
  8. 1406981Domain d1ayzb_: 1ayz B: [38327]

Details for d1ayzb_

PDB Entry: 1ayz (more details), 2.6 Å

PDB Description: crystal structure of the saccharomyces cerevisiae ubiquitin-conjugating enzyme rad6 (ubc2) at 2.6a resolution
PDB Compounds: (B:) ubiquitin-conjugating enzyme rad6

SCOPe Domain Sequences for d1ayzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayzb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]}
stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
anveaatlfkdhksqyvkrvketveksweddmd

SCOPe Domain Coordinates for d1ayzb_:

Click to download the PDB-style file with coordinates for d1ayzb_.
(The format of our PDB-style files is described here.)

Timeline for d1ayzb_: