| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) |
Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) ![]() |
| Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) |
| Protein Ubiquitin conjugating enzyme [54497] (7 species) |
| Species Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId:4932] [54499] (1 PDB entry) |
| Domain d1ayzb_: 1ayz B: [38327] |
PDB Entry: 1ayz (more details), 2.6 Å
SCOP Domain Sequences for d1ayzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayzb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6)}
stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
anveaatlfkdhksqyvkrvketveksweddmd
Timeline for d1ayzb_: