Lineage for d1ayzb_ (1ayz B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (7 species) 
Species Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId:4932] [54499] (1 PDB entry) 
Domain d1ayzb_: 1ayz B: [38327]
Details for d1ayzb_
PDB Entry: 1ayz (more details), 2.6 Å
PDB Description: crystal structure of the saccharomyces cerevisiae ubiquitin-conjugating enzyme rad6 (ubc2) at 2.6a resolution
SCOP Domain Sequences for d1ayzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayzb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6)}
stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
anveaatlfkdhksqyvkrvketveksweddmd
SCOP Domain Coordinates for d1ayzb_:
Click to download the PDB-style file with coordinates for d1ayzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayzb_:
- d1ayzb_ appears in SCOP 1.57
- d1ayzb_ appears in the current release, SCOPe 2.08
View in 3D
