SCOP 1.67: Domain d2aak__: 2aak -

Lineage for d2aak__ (2aak -)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (2 families)

5. Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (17 species)

7. Species Arabidopsis thaliana [TaxId:3702] [54498] (1 PDB entry)

8. Domain d2aak__: 2aak - [38325]

Details for d2aak__

PDB Entry: 2aak, 2.4 Å

PDB Description: ubiquitin conjugating enzyme from arabidopsis thaliana

SCOP Domain Sequences for d2aak__:

Sequence; same for both SEQRES and ATOM records:

>d2aak__ d.20.1.1 (-) Ubiquitin conjugating enzyme, UBC {Arabidopsis thaliana}
mstparkrlmrdfkrlqqdppagisgapqdnnimlwnavifgpddtpwdggtfklslqfs
edypnkpptvrfvsrmfhpniyadgsicldilqnqwspiydvaailtsiqsllcdpnpns
panseaarmyseskreynrrvrdvveqswt

Timeline for d2aak__:

• d2aak__ first appeared (with stable ids) in SCOP 1.55
  
• d2aak__ appears in SCOP 1.65
  
• d2aak__ appears in SCOP 1.69
  
• d2aak__ appears in the current release, SCOPe 2.08, called d2aaka_