Lineage for d2aak__ (2aak -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (7 species) 
Species Arabidopsis thaliana [TaxId:3702] [54498] (1 PDB entry) 
Domain d2aak__: 2aak - [38325]
Details for d2aak__
PDB Entry: 2aak (more details), 2.4 Å
PDB Description: ubiquitin conjugating enzyme from arabidopsis thaliana
SCOP Domain Sequences for d2aak__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aak__ d.20.1.1 (-) Ubiquitin conjugating enzyme {Arabidopsis thaliana}
mstparkrlmrdfkrlqqdppagisgapqdnnimlwnavifgpddtpwdggtfklslqfs
edypnkpptvrfvsrmfhpniyadgsicldilqnqwspiydvaailtsiqsllcdpnpns
panseaarmyseskreynrrvrdvveqswt
SCOP Domain Coordinates for d2aak__:
Click to download the PDB-style file with coordinates for d2aak__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aak__:
- d2aak__ appears in SCOP 1.57
- d2aak__ appears in the current release, SCOPe 2.08, called d2aaka_
View in 3D