SCOPe 2.08: Domain d6rjia1: 6rji A:1-63

Lineage for d6rjia1 (6rji A:1-63)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [383241] (1 PDB entry)

8. Domain d6rjia1: 6rji A:1-63 [383242]
   Other proteins in same PDB: d6rjia2, d6rjia3
   automated match to d1ueba1

Details for d6rjia1

PDB Entry: 6rji, 1.48 Å

PDB Description: x-ray structure of the elongation factor p of s. aureus

PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d6rjia1:

Sequence; same for both SEQRES and ATOM records:

>d6rjia1 b.34.5.0 (A:1-63) automated matches {Staphylococcus aureus [TaxId: 93061]}
misvndfktgltisvdnaiwkvidfqhvkpgkgsafvrsklrnlrtgaiqektfragekv
epa

Timeline for d6rjia1:

• d6rjia1 first appeared in SCOPe 2.07