| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein automated matches [191209] (6 species) not a true protein |
| Species Candida auris [TaxId:498019] [383232] (1 PDB entry) |
| Domain d6vsia_: 6vsi A: [383233] automated match to d1yata_ complexed with so4 |
PDB Entry: 6vsi (more details), 1.87 Å
SCOPe Domain Sequences for d6vsia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vsia_ d.26.1.1 (A:) automated matches {Candida auris [TaxId: 498019]}
mapntteveiisegdgkvfpkvgdtvtihytgtlengkkfdssrdrgkpfqctigvghvi
kgwdigipklsvgsqakltipgheaygsrgfpglippdatlifdvellgvn
Timeline for d6vsia_: