Lineage for d6vsia_ (6vsi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941584Protein automated matches [191209] (6 species)
    not a true protein
  7. 2941585Species Candida auris [TaxId:498019] [383232] (1 PDB entry)
  8. 2941586Domain d6vsia_: 6vsi A: [383233]
    automated match to d1yata_
    complexed with so4

Details for d6vsia_

PDB Entry: 6vsi (more details), 1.87 Å

PDB Description: crystal structure of fkbp12 of candida auris
PDB Compounds: (A:) peptidylprolyl isomerase

SCOPe Domain Sequences for d6vsia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vsia_ d.26.1.1 (A:) automated matches {Candida auris [TaxId: 498019]}
mapntteveiisegdgkvfpkvgdtvtihytgtlengkkfdssrdrgkpfqctigvghvi
kgwdigipklsvgsqakltipgheaygsrgfpglippdatlifdvellgvn

SCOPe Domain Coordinates for d6vsia_:

Click to download the PDB-style file with coordinates for d6vsia_.
(The format of our PDB-style files is described here.)

Timeline for d6vsia_: