Lineage for d1c16g2 (1c16 G:1-180)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719375Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 719386Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (2 PDB entries)
  8. 719390Domain d1c16g2: 1c16 G:1-180 [38323]
    Other proteins in same PDB: d1c16a1, d1c16b_, d1c16c1, d1c16d_, d1c16e1, d1c16f_, d1c16g1, d1c16h_

Details for d1c16g2

PDB Entry: 1c16 (more details), 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22
PDB Compounds: (G:) MHC-like protein t22

SCOP Domain Sequences for d1c16g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c16g2 d.19.1.1 (G:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll

SCOP Domain Coordinates for d1c16g2:

Click to download the PDB-style file with coordinates for d1c16g2.
(The format of our PDB-style files is described here.)

Timeline for d1c16g2: