Lineage for d1c16e2 (1c16 E:1-180)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544705Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 2544716Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (2 PDB entries)
  8. 2544719Domain d1c16e2: 1c16 E:1-180 [38322]
    Other proteins in same PDB: d1c16a1, d1c16b_, d1c16c1, d1c16d_, d1c16e1, d1c16f_, d1c16g1, d1c16h_

Details for d1c16e2

PDB Entry: 1c16 (more details), 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22
PDB Compounds: (E:) MHC-like protein t22

SCOPe Domain Sequences for d1c16e2:

Sequence, based on SEQRES records: (download)

>d1c16e2 d.19.1.1 (E:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll

Sequence, based on observed residues (ATOM records): (download)

>d1c16e2 d.19.1.1 (E:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctphisqdlkshcsdllqkylekgkerll

SCOPe Domain Coordinates for d1c16e2:

Click to download the PDB-style file with coordinates for d1c16e2.
(The format of our PDB-style files is described here.)

Timeline for d1c16e2: