Lineage for d1c16c2 (1c16 C:1-180)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 132079Protein MHC I homolog [54489] (2 species)
  7. 132083Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (1 PDB entry)
  8. 132085Domain d1c16c2: 1c16 C:1-180 [38321]
    Other proteins in same PDB: d1c16a1, d1c16b1, d1c16c1, d1c16d1, d1c16e1, d1c16f1, d1c16g1, d1c16h1

Details for d1c16c2

PDB Entry: 1c16 (more details), 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22

SCOP Domain Sequences for d1c16c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c16c2 d.19.1.1 (C:1-180) MHC I homolog {Mouse (Mus musculus), t22}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll

SCOP Domain Coordinates for d1c16c2:

Click to download the PDB-style file with coordinates for d1c16c2.
(The format of our PDB-style files is described here.)

Timeline for d1c16c2: