SCOPe 2.08: Domain d6pvcg2: 6pvc G:111-202

Lineage for d6pvcg2 (6pvc G:111-202)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6pvcg2: 6pvc G:111-202 [383208]
   Other proteins in same PDB: d6pvca1, d6pvca2, d6pvca3, d6pvcb1, d6pvcb2, d6pvcc1, d6pvcc2, d6pvcc3, d6pvcd1, d6pvcd2, d6pvce1, d6pvcf1, d6pvcf2, d6pvcg1, d6pvch1, d6pvch2
   automated match to d2f54d2
   complexed with act, gol, na, p1j

Details for d6pvcg2

PDB Entry: 6pvc, 1.96 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-db28

PDB Compounds: (G:) Human TCR alpha chain

SCOPe Domain Sequences for d6pvcg2:

Sequence; same for both SEQRES and ATOM records:

>d6pvcg2 b.1.1.2 (G:111-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspes

Timeline for d6pvcg2:

• d6pvcg2 first appeared in SCOPe 2.07