Lineage for d1b3ja2 (1b3j A:1-180)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31366Protein MHC I homolog [54489] (2 species)
  7. 31367Species Human (Homo sapiens), Mic-a [TaxId:9606] [54490] (1 PDB entry)
  8. 31368Domain d1b3ja2: 1b3j A:1-180 [38319]
    Other proteins in same PDB: d1b3ja1

Details for d1b3ja2

PDB Entry: 1b3j (more details), 3 Å

PDB Description: structure of the mhc class i homolog mic-a, a gammadelta t cell ligand

SCOP Domain Sequences for d1b3ja2:

Sequence, based on SEQRES records: (download)

>d1b3ja2 d.19.1.1 (A:1-180) MHC I homolog {Human (Homo sapiens), Mic-a}
ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
nletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlrr

Sequence, based on observed residues (ATOM records): (download)

>d1b3ja2 d.19.1.1 (A:1-180) MHC I homolog {Human (Homo sapiens), Mic-a}
ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
nletkewtmpqssraqtlamnvrnflkedamadclqelrrylksgvvlrr

SCOP Domain Coordinates for d1b3ja2:

Click to download the PDB-style file with coordinates for d1b3ja2.
(The format of our PDB-style files is described here.)

Timeline for d1b3ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3ja1