Lineage for d6hkqa1 (6hkq A:6-170)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. Protein automated matches [190056] (192 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. Domain d6hkqa1: 6hkq A:6-170 [383182]
    Other proteins in same PDB: d6hkqa2
    automated match to d2obia_
    complexed with dms, edo, g9n, so4

Details for d6hkqa1

PDB Entry: 6hkq (more details), 1.54 Å

PDB Description: human gpx4 in complex with covalent inhibitor ml162 (s enantiomer)
PDB Compounds: (A:) Phospholipid hydroperoxide glutathione peroxidase

SCOPe Domain Sequences for d6hkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hkqa1 c.47.1.0 (A:6-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddwrcarsmhefsakdidghmvnldkyrgfvcivtnvasqagktevnytqlvdlharyae
sglrilafpcnqfgkqepgsneeikefaagynvkfdmfskicvngddahplwkwmkiqpk
gkgilgnaikwnftkflidkngcvvkrygpmeeplviekdlphyf

SCOPe Domain Coordinates for d6hkqa1 are not available.

Timeline for d6hkqa1:

Domains from same chain:
(mouse over for more information)
d6hkqa2