SCOPe 2.02: Domain d1zagd2: 1zag D:6-183

Lineage for d1zagd2 (1zag D:6-183)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries)
   Uniprot P25311 22-294

8. Domain d1zagd2: 1zag D:6-183 [38318]
   Other proteins in same PDB: d1zaga1, d1zagb1, d1zagc1, d1zagd1
   complexed with nag, ndg

Details for d1zagd2

PDB Entry: 1zag, 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

PDB Compounds: (D:) protein (zinc-alpha-2-glycoprotein)

SCOPe Domain Sequences for d1zagd2:

Sequence; same for both SEQRES and ATOM records:

>d1zagd2 d.19.1.1 (D:6-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
grysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwkq
dsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdyi
efnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

Timeline for d1zagd2:

• d1zagd2 first appeared (with stable ids) in SCOP 1.55
  
• d1zagd2 appears in SCOPe 2.01
  
• d1zagd2 appears in SCOPe 2.03
  
• d1zagd2 appears in the current release, SCOPe 2.08