Lineage for d1zagd2 (1zag D:6-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719992Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 719993Species Human (Homo sapiens) [TaxId:9606] [54488] (8 PDB entries)
  8. 720001Domain d1zagd2: 1zag D:6-183 [38318]
    Other proteins in same PDB: d1zaga1, d1zagb1, d1zagc1, d1zagd1
    complexed with gal, man, nag, sia

Details for d1zagd2

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein
PDB Compounds: (D:) protein (zinc-alpha-2-glycoprotein)

SCOP Domain Sequences for d1zagd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagd2 d.19.1.1 (D:6-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
grysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwkq
dsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdyi
efnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOP Domain Coordinates for d1zagd2:

Click to download the PDB-style file with coordinates for d1zagd2.
(The format of our PDB-style files is described here.)

Timeline for d1zagd2: