SCOPe 2.08: Domain d6r07a1: 6r07 A:4-358

Lineage for d6r07a1 (6r07 A:4-358)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries)

8. Domain d6r07a1: 6r07 A:4-358 [383164]
   Other proteins in same PDB: d6r07a2
   automated match to d1yhla_
   complexed with 3n2, dms, so4, zn

Details for d6r07a1

PDB Entry: 6r07, 1.57 Å

PDB Description: t. cruzi fpps in complex with 2-(5-chlorobenzo[b]thiophen-3-yl)acetic acid

PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d6r07a1:

Sequence; same for both SEQRES and ATOM records:

>d6r07a1 a.128.1.0 (A:4-358) automated matches {Trypanosoma cruzi [TaxId: 5693]}
merflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvaegfl
avtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvttqc
aindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkldpe
vaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlvervahlig
eyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygekdpa
kvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekth

Timeline for d6r07a1:

• d6r07a1 first appeared in SCOPe 2.07