SCOPe 2.08: Domain d6obmb_: 6obm B:

Lineage for d6obmb_ (6obm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d6obmb_: 6obm B: [383162]
   Other proteins in same PDB: d6obma_
   automated match to d4lhjb_
   complexed with cl

Details for d6obmb_

PDB Entry: 6obm, 2.5 Å

PDB Description: ricin a chain bound to vhh antibody v6a7

PDB Compounds: (B:) VHH antibody V6A7

SCOPe Domain Sequences for d6obmb_:

Sequence, based on SEQRES records:

>d6obmb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvetgggglvqaggslrlscaasgsisslnamgwyrqapgkerelvadisasgrtny
adsvkgrftisrdnakntvslqmnslkpedtavyycnavggtyyydeydywgqgtqvtvs

Sequence, based on observed residues (ATOM records):

>d6obmb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvetglvqaggslrlscaasgsisslnamgwyrqapgkerelvadisasgrtnyads
vkgrftisrdnakntvslqmnslkpedtavyycnavggtyyydeydywgqgtqvtvs

Timeline for d6obmb_:

• d6obmb_ first appeared in SCOPe 2.07