Lineage for d1zagb2 (1zag B:5-183)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198719Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 1198720Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries)
    Uniprot P25311 22-294
  8. 1198726Domain d1zagb2: 1zag B:5-183 [38316]
    Other proteins in same PDB: d1zaga1, d1zagb1, d1zagc1, d1zagd1
    complexed with nag, ndg

Details for d1zagb2

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein
PDB Compounds: (B:) protein (zinc-alpha-2-glycoprotein)

SCOPe Domain Sequences for d1zagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagb2 d.19.1.1 (B:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOPe Domain Coordinates for d1zagb2:

Click to download the PDB-style file with coordinates for d1zagb2.
(The format of our PDB-style files is described here.)

Timeline for d1zagb2: