Lineage for d1zagb2 (1zag B:5-183)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255559Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to MHC I
  7. 255560Species Human (Homo sapiens) [TaxId:9606] [54488] (1 PDB entry)
  8. 255562Domain d1zagb2: 1zag B:5-183 [38316]
    Other proteins in same PDB: d1zaga1, d1zagb1, d1zagc1, d1zagd1

Details for d1zagb2

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagb2 d.19.1.1 (B:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOP Domain Coordinates for d1zagb2:

Click to download the PDB-style file with coordinates for d1zagb2.
(The format of our PDB-style files is described here.)

Timeline for d1zagb2: