Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [189349] (72 PDB entries) |
Domain d6s0ha_: 6s0h A: [383158] automated match to d5ewac_ complexed with edo, kq8, zn |
PDB Entry: 6s0h (more details), 2.85 Å
SCOPe Domain Sequences for d6s0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s0ha_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lpdlkiekleegvfvhtsfeevngwgvvtkhglvvlvntdaylidtpftatdteklvnwf vergyeikgtisshfhsdstggiewlnsqsiptyaseltnellkksgkvqakysfsevsy wlvknkievfypgpghtqdnlvvwlpeskilfggcfikphglgnlgdanleawpksakil mskygkaklvvsshsekgdaslmkrtweqalkglke
Timeline for d6s0ha_: