![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Neuroglobin [100978] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109625] (38 PDB entries) Uniprot Q9ER97 |
![]() | Domain d6r1qa_: 6r1q A: [383152] automated match to d1q1fa_ complexed with ar, cl, hem, so4 |
PDB Entry: 6r1q (more details), 1.95 Å
SCOPe Domain Sequences for d6r1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r1qa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg pdftpatrtawsrlygavvqamsrgwdg
Timeline for d6r1qa_: