SCOPe 2.08: Domain d6pvdd1: 6pvd D:2-110

Lineage for d6pvdd1 (6pvd D:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6pvdd1: 6pvd D:2-110 [383147]
   Other proteins in same PDB: d6pvda1, d6pvda3, d6pvdb1, d6pvdb2, d6pvdc1, d6pvdc3, d6pvdd2, d6pvdf1, d6pvdf2, d6pvdg2
   automated match to d2f54d1
   complexed with act, gol, n18, na

Details for d6pvdd1

PDB Entry: 6pvd, 2.14 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-nv18.1

PDB Compounds: (D:) Human TCR alpha chain

SCOPe Domain Sequences for d6pvdd1:

Sequence; same for both SEQRES and ATOM records:

>d6pvdd1 b.1.1.0 (D:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

Timeline for d6pvdd1:

• d6pvdd1 first appeared in SCOPe 2.07