Lineage for d1ed3a2 (1ed3 A:1-181)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163098Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2163602Species Norway rat (Rattus norvegicus), RT1-AA [TaxId:10116] [54486] (3 PDB entries)
  8. 2163605Domain d1ed3a2: 1ed3 A:1-181 [38313]
    Other proteins in same PDB: d1ed3a1, d1ed3b_, d1ed3d1, d1ed3e_

Details for d1ed3a2

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1-aa/mtf-e.
PDB Compounds: (A:) class I major histocompatibility antigen rt1-aa

SCOPe Domain Sequences for d1ed3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Norway rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
r

SCOPe Domain Coordinates for d1ed3a2:

Click to download the PDB-style file with coordinates for d1ed3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ed3a2: