Lineage for d1ddha2 (1ddh A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856608Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 856644Domain d1ddha2: 1ddh A:1-181 [38312]
    Other proteins in same PDB: d1ddha1, d1ddhb_
    mutant

Details for d1ddha2

PDB Entry: 1ddh (more details), 3.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120
PDB Compounds: (A:) MHC class I h-2dd heavy chain

SCOP Domain Sequences for d1ddha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddha2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
mshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
eretrrangneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
a

SCOP Domain Coordinates for d1ddha2:

Click to download the PDB-style file with coordinates for d1ddha2.
(The format of our PDB-style files is described here.)

Timeline for d1ddha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddha1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ddhb_