SCOP 1.57: Domain d1ddha2: 1ddh A:1-181

Lineage for d1ddha2 (1ddh A:1-181)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (3 PDB entries)

8. Domain d1ddha2: 1ddh A:1-181 [38312]
   Other proteins in same PDB: d1ddha1, d1ddhb1

Details for d1ddha2

PDB Entry: 1ddh, 3.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120

SCOP Domain Sequences for d1ddha2:

Sequence; same for both SEQRES and ATOM records:

>d1ddha2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD}
mshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
eretrrangneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
a

Timeline for d1ddha2:

• d1ddha2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddha2 appears in SCOP 1.59
  
• d1ddha2 appears in the current release, SCOPe 2.08