| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries) |
| Domain d1biia2: 1bii A:1-181 [38311] Other proteins in same PDB: d1biia1, d1biib_ |
PDB Entry: 1bii (more details), 2.4 Å
SCOPe Domain Sequences for d1biia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1biia2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
gshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
eretrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
r
Timeline for d1biia2: