Lineage for d1ld9d2 (1ld9 D:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545261Species Mouse (Mus musculus), H-2LD [TaxId:10090] [54484] (2 PDB entries)
  8. 2545263Domain d1ld9d2: 1ld9 D:1-181 [38308]
    Other proteins in same PDB: d1ld9a1, d1ld9b_, d1ld9d1, d1ld9e_

Details for d1ld9d2

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide
PDB Compounds: (D:) MHC class I h-2ld heavy chain

SCOPe Domain Sequences for d1ld9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2LD [TaxId: 10090]}
gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1ld9d2:

Click to download the PDB-style file with coordinates for d1ld9d2.
(The format of our PDB-style files is described here.)

Timeline for d1ld9d2: