![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2LD [TaxId:10090] [54484] (2 PDB entries) |
![]() | Domain d1ld9d2: 1ld9 D:1-181 [38308] Other proteins in same PDB: d1ld9a1, d1ld9b_, d1ld9d1, d1ld9e_ |
PDB Entry: 1ld9 (more details), 2.4 Å
SCOPe Domain Sequences for d1ld9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld9d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2LD [TaxId: 10090]} gphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpeyw eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg cdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatll r
Timeline for d1ld9d2:
![]() Domains from other chains: (mouse over for more information) d1ld9a1, d1ld9a2, d1ld9b_, d1ld9e_ |