Lineage for d1mhcd2 (1mhc D:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021274Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [54483] (1 PDB entry)
  8. 1021276Domain d1mhcd2: 1mhc D:1-181 [38306]
    Other proteins in same PDB: d1mhca1, d1mhcb_, d1mhcd1, d1mhce_
    complexed with nag

Details for d1mhcd2

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
PDB Compounds: (D:) MHC class I antigen h2-m3

SCOPe Domain Sequences for d1mhcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhcd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M3 [TaxId: 10090]}
gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
r

SCOPe Domain Coordinates for d1mhcd2:

Click to download the PDB-style file with coordinates for d1mhcd2.
(The format of our PDB-style files is described here.)

Timeline for d1mhcd2: