Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [54483] (1 PDB entry) |
Domain d1mhcd2: 1mhc D:1-181 [38306] Other proteins in same PDB: d1mhca1, d1mhcb_, d1mhcd1, d1mhce_ complexed with nag |
PDB Entry: 1mhc (more details), 2.1 Å
SCOPe Domain Sequences for d1mhcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhcd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M3 [TaxId: 10090]} gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq r
Timeline for d1mhcd2:
View in 3D Domains from other chains: (mouse over for more information) d1mhca1, d1mhca2, d1mhcb_, d1mhce_ |