SCOPe 2.08: Domain d1mhcd2: 1mhc D:1-181

Lineage for d1mhcd2 (1mhc D:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [54483] (1 PDB entry)

8. Domain d1mhcd2: 1mhc D:1-181 [38306]
   Other proteins in same PDB: d1mhca1, d1mhcb_, d1mhcd1, d1mhce_
   complexed with nag

Details for d1mhcd2

PDB Entry: 1mhc, 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

PDB Compounds: (D:) MHC class I antigen h2-m3

SCOPe Domain Sequences for d1mhcd2:

Sequence; same for both SEQRES and ATOM records:

>d1mhcd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M3 [TaxId: 10090]}
gshslryfhtavsrpgrgepqyisvgyvddvqfqrcdsieeiprmeprapwmekerpeyw
kelklkvkniaqsaranlrtllryynqseggshilqwmvscevgpdmrllgahyqaaydg
sdyitlnedlsswtavdmvsqitksrlesagtaeyfrayvegeclellhrflrngkeilq
r

Timeline for d1mhcd2:

• d1mhcd2 first appeared (with stable ids) in SCOP 1.55
  
• d1mhcd2 appears in SCOPe 2.07