SCOPe 2.08: Domain d6oo0l2: 6oo0 L:108-212

Lineage for d6oo0l2 (6oo0 L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225911] (2 PDB entries)

8. Domain d6oo0l2: 6oo0 L:108-212 [383040]
   Other proteins in same PDB: d6oo0l1
   automated match to d1lila2
   complexed with mpd

Details for d6oo0l2

PDB Entry: 6oo0, 2.1 Å

PDB Description: crystal structure of bovine fab nc-cow1

PDB Compounds: (L:) NC-Cow1 light chain

SCOPe Domain Sequences for d6oo0l2:

Sequence; same for both SEQRES and ATOM records:

>d6oo0l2 b.1.1.2 (L:108-212) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d6oo0l2:

• d6oo0l2 first appeared in SCOPe 2.07