![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225911] (2 PDB entries) |
![]() | Domain d6oo0l2: 6oo0 L:108-212 [383040] Other proteins in same PDB: d6oo0l1 automated match to d1lila2 complexed with mpd |
PDB Entry: 6oo0 (more details), 2.1 Å
SCOPe Domain Sequences for d6oo0l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oo0l2 b.1.1.2 (L:108-212) automated matches {Cow (Bos taurus) [TaxId: 9913]} qpksppsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d6oo0l2: