Lineage for d1bz9a2 (1bz9 A:2-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545067Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)
  8. 2545113Domain d1bz9a2: 1bz9 A:2-181 [38304]
    Other proteins in same PDB: d1bz9a1, d1bz9b2, d1bz9b3

Details for d1bz9a2

PDB Entry: 1bz9 (more details), 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
PDB Compounds: (A:) protein (class I histocompatibility antigen)

SCOPe Domain Sequences for d1bz9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz9a2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1bz9a2:

Click to download the PDB-style file with coordinates for d1bz9a2.
(The format of our PDB-style files is described here.)

Timeline for d1bz9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz9a1