SCOP 1.55: Domain d1bz9a2: 1bz9 A:2-181

Lineage for d1bz9a2 (1bz9 A:2-181)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (5 PDB entries)

8. Domain d1bz9a2: 1bz9 A:2-181 [38304]
   Other proteins in same PDB: d1bz9a1, d1bz9b1

Details for d1bz9a2

PDB Entry: 1bz9, 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027

SCOP Domain Sequences for d1bz9a2:

Sequence; same for both SEQRES and ATOM records:

>d1bz9a2 d.19.1.1 (A:2-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1bz9a2:

• d1bz9a2 appears in SCOP 1.57
  
• d1bz9a2 appears in the current release, SCOPe 2.08