SCOPe 2.07: Domain d6oo0l1: 6oo0 L:2-107

Lineage for d6oo0l1 (6oo0 L:2-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (16 PDB entries)

8. Domain d6oo0l1: 6oo0 L:2-107 [383039]
   Other proteins in same PDB: d6oo0l2
   automated match to d1lila1
   complexed with mpd

Details for d6oo0l1

PDB Entry: 6oo0, 2.1 Å

PDB Description: crystal structure of bovine fab nc-cow1

PDB Compounds: (L:) NC-Cow1 light chain

SCOPe Domain Sequences for d6oo0l1:

Sequence; same for both SEQRES and ATOM records:

>d6oo0l1 b.1.1.0 (L:2-107) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yeltqpssvsgslgqrvsvtcsgsssnvgngyvswyqlipgsaprtiiygdtsrasgvpe
rfsgsrsgntatltisslqaedeadffcaspddsssnavfgsgttltvlg

Timeline for d6oo0l1:

• d6oo0l1 is new in SCOPe 2.07-stable
  
• d6oo0l1 appears in the current release, SCOPe 2.08