Lineage for d6o8ob_ (6o8o B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695014Species Rhodobacter capsulatus [TaxId:1061] [383009] (5 PDB entries)
  8. 2695021Domain d6o8ob_: 6o8o B: [383014]
    automated match to d3jtha_
    complexed with cl, so4

Details for d6o8ob_

PDB Entry: 6o8o (more details), 2.5 Å

PDB Description: crystal structure of c9s disulfide state of sulfide-responsive transcriptional repressor (sqrr) from rhodobacter capsulatus.
PDB Compounds: (B:) Transcriptional regulator, ArsR family

SCOPe Domain Sequences for d6o8ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o8ob_ a.4.5.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
mgsdtdersaaldaeematraraasnllkalahegrlmimcylasgeksvteletrlstr
qaavsqqlarlrleglvqsrregktiyyslsdpraarvvqtvyeqfcs

SCOPe Domain Coordinates for d6o8ob_:

Click to download the PDB-style file with coordinates for d6o8ob_.
(The format of our PDB-style files is described here.)

Timeline for d6o8ob_: