Lineage for d1fg2d2 (1fg2 D:2-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600377Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 600403Domain d1fg2d2: 1fg2 D:2-181 [38301]
    Other proteins in same PDB: d1fg2a1, d1fg2b_, d1fg2d1, d1fg2e_, d1fg2g1, d1fg2h_, d1fg2j1, d1fg2k_

Details for d1fg2d2

PDB Entry: 1fg2 (more details), 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg2d2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOP Domain Coordinates for d1fg2d2:

Click to download the PDB-style file with coordinates for d1fg2d2.
(The format of our PDB-style files is described here.)

Timeline for d1fg2d2: