SCOP 1.63: Domain d1fg2a2: 1fg2 A:2-181

Lineage for d1fg2a2 (1fg2 A:2-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (13 PDB entries)

8. Domain d1fg2a2: 1fg2 A:2-181 [38300]
   Other proteins in same PDB: d1fg2a1, d1fg2b_, d1fg2d1, d1fg2e_, d1fg2g1, d1fg2h_, d1fg2j1, d1fg2k_

Details for d1fg2a2

PDB Entry: 1fg2, 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2a2:

Sequence; same for both SEQRES and ATOM records:

>d1fg2a2 d.19.1.1 (A:2-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1fg2a2:

• d1fg2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1fg2a2 appears in SCOP 1.61
  
• d1fg2a2 appears in SCOP 1.65
  
• d1fg2a2 appears in the current release, SCOPe 2.08