Lineage for d6jqxb1 (6jqx B:1-349)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2442705Protein automated matches [190150] (34 species)
    not a true protein
  7. 2442738Species Cutaneotrichosporon moniliiforme [TaxId:1895941] [382960] (2 PDB entries)
  8. 2442742Domain d6jqxb1: 6jqx B:1-349 [382999]
    Other proteins in same PDB: d6jqxa2, d6jqxb2
    automated match to d2dvxa_
    complexed with sal, zn

Details for d6jqxb1

PDB Entry: 6jqx (more details), 1.67 Å

PDB Description: crystal structure of a hydrogenase from trichosporon moniliiforme
PDB Compounds: (B:) Salicylate decarboxylase

SCOPe Domain Sequences for d6jqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jqxb1 c.1.9.0 (B:1-349) automated matches {Cutaneotrichosporon moniliiforme [TaxId: 1895941]}
mrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigyti
ysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseeltrc
vkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsylrn
qyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwriehwf
ehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvdsp
yehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydse

SCOPe Domain Coordinates for d6jqxb1:

Click to download the PDB-style file with coordinates for d6jqxb1.
(The format of our PDB-style files is described here.)

Timeline for d6jqxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6jqxb2