SCOPe 2.08: Domain d6jqxb1: 6jqx B:1-349

Lineage for d6jqxb1 (6jqx B:1-349)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Cutaneotrichosporon moniliiforme [TaxId:1895941] [382960] (2 PDB entries)

8. Domain d6jqxb1: 6jqx B:1-349 [382999]
   Other proteins in same PDB: d6jqxa2, d6jqxb2
   automated match to d2dvxa_
   complexed with sal, zn

Details for d6jqxb1

PDB Entry: 6jqx, 1.67 Å

PDB Description: crystal structure of a hydrogenase from trichosporon moniliiforme

PDB Compounds: (B:) Salicylate decarboxylase

SCOPe Domain Sequences for d6jqxb1:

Sequence; same for both SEQRES and ATOM records:

>d6jqxb1 c.1.9.0 (B:1-349) automated matches {Cutaneotrichosporon moniliiforme [TaxId: 1895941]}
mrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigyti
ysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseeltrc
vkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsylrn
qyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwriehwf
ehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvdsp
yehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydse

Timeline for d6jqxb1:

• d6jqxb1 first appeared in SCOPe 2.07