Lineage for d6hn3a1 (6hn3 A:5-170)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (188 species)
    not a true protein
  7. 2458070Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 3082935Domain d6hn3a1: 6hn3 A:5-170 [382997]
    Other proteins in same PDB: d6hn3a2
    automated match to d2obia_
    complexed with cl, eoh

Details for d6hn3a1

PDB Entry: 6hn3 (more details), 1.01 Å

PDB Description: wildtype form (apo) of human gpx4 with se-cys46
PDB Compounds: (A:) Phospholipid hydroperoxide glutathione peroxidase

SCOPe Domain Sequences for d6hn3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hn3a1 c.47.1.0 (A:5-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rddwrcarsmhefsakdidghmvnldkyrgfvcivtnvasqagktevnytqlvdlharya
ecglrilafpcnqfgkqepgsneeikefaagynvkfdmfskicvngddahplwkwmkiqp
kgkgilgnaikwnftkflidkngcvvkrygpmeeplviekdlphyf

SCOPe Domain Coordinates for d6hn3a1:

Click to download the PDB-style file with coordinates for d6hn3a1.
(The format of our PDB-style files is described here.)

Timeline for d6hn3a1:

  • d6hn3a1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6hn3a2