Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries) |
Domain d1ce6a2: 1ce6 A:1-181 [38299] Other proteins in same PDB: d1ce6a1, d1ce6b_ complexed with so4 |
PDB Entry: 1ce6 (more details), 2.9 Å
SCOPe Domain Sequences for d1ce6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce6a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d1ce6a2: