Lineage for d6jzyb_ (6jzy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703838Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2703849Protein automated matches [261918] (5 species)
    not a true protein
  7. 2703860Species Synechococcus elongatus [TaxId:1140] [261919] (8 PDB entries)
  8. 2703867Domain d6jzyb_: 6jzy B: [382988]
    automated match to d4quwa_
    complexed with fe2, ndp, ocd, pl3

Details for d6jzyb_

PDB Entry: 6jzy (more details), 2.1 Å

PDB Description: crystal structure of aar with nadph and stearyl in complex with ado binding a long chain carbohydrate
PDB Compounds: (B:) Aldehyde decarbonylase

SCOPe Domain Sequences for d6jzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jzyb_ a.25.1.6 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]}
dfqsesykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfmac
gknlsvtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaayniyipvad
afarkitegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevaddare
lgmereslvedfmiaygealenigfttreimrmsaygl

SCOPe Domain Coordinates for d6jzyb_:

Click to download the PDB-style file with coordinates for d6jzyb_.
(The format of our PDB-style files is described here.)

Timeline for d6jzyb_: