Lineage for d6lvjb_ (6lvj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996874Species Escherichia coli [TaxId:562] [382986] (1 PDB entry)
  8. 2996876Domain d6lvjb_: 6lvj B: [382987]
    automated match to d5ev8c_
    complexed with zn

Details for d6lvjb_

PDB Entry: 6lvj (more details), 1.83 Å

PDB Description: imp-6 metallo-beta-lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6lvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lvjb_ d.157.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpghsevgdasllkltleqavkglne

SCOPe Domain Coordinates for d6lvjb_:

Click to download the PDB-style file with coordinates for d6lvjb_.
(The format of our PDB-style files is described here.)

Timeline for d6lvjb_: