SCOP 1.55: Domain d1hoca2: 1hoc A:1-181

Lineage for d1hoca2 (1hoc A:1-181)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (5 PDB entries)

8. Domain d1hoca2: 1hoc A:1-181 [38297]
   Other proteins in same PDB: d1hoca1, d1hocb1

Details for d1hoca2

PDB Entry: 1hoc, 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection

SCOP Domain Sequences for d1hoca2:

Sequence; same for both SEQRES and ATOM records:

>d1hoca2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d1hoca2:

• d1hoca2 appears in SCOP 1.57
  
• d1hoca2 appears in the current release, SCOPe 2.08