Lineage for d1hoca2 (1hoc A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938003Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)
  8. 2938047Domain d1hoca2: 1hoc A:1-181 [38297]
    Other proteins in same PDB: d1hoca1, d1hocb_

Details for d1hoca2

PDB Entry: 1hoc (more details), 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
PDB Compounds: (A:) class I histocompatibility antigen (h2-db) (alpha chain)

SCOPe Domain Sequences for d1hoca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoca2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1hoca2:

Click to download the PDB-style file with coordinates for d1hoca2.
(The format of our PDB-style files is described here.)

Timeline for d1hoca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hoca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hocb_